Cow ASIP protein

Catalog Number: BYT-ORB358728
Article Name: Cow ASIP protein
Biozol Catalog Number: BYT-ORB358728
Supplier Catalog Number: orb358728
Alternative Catalog Number: BYT-ORB358728-20,BYT-ORB358728-100,BYT-ORB358728-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Agouti switch protein
This Cow ASIP protein spans the amino acid sequence from region 23-133aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 28.4 kDa
UniProt: Q29414
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bos taurus (Bovine)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC
Application Notes: Biological Origin: Bos taurus (Bovine). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.