Drosophila RpII215 protein

Catalog Number: BYT-ORB358719
Article Name: Drosophila RpII215 protein
Biozol Catalog Number: BYT-ORB358719
Supplier Catalog Number: orb358719
Alternative Catalog Number: BYT-ORB358719-20,BYT-ORB358719-100,BYT-ORB358719-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: DNA-directed RNA polymerase III largest subunit
This Drosophila RpII215 protein spans the amino acid sequence from region 1579-1881aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 33.6 kDa
UniProt: P04052
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Drosophila melanogaster (Fruit fly)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYS
Application Notes: Biological Origin: Drosophila melanogaster (Fruit fly). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.