Fungi HSP70 protein

Catalog Number: BYT-ORB358716
Article Name: Fungi HSP70 protein
Biozol Catalog Number: BYT-ORB358716
Supplier Catalog Number: orb358716
Alternative Catalog Number: BYT-ORB358716-20,BYT-ORB358716-100,BYT-ORB358716-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen, Alt a 3
This Fungi HSP70 protein spans the amino acid sequence from region 1-152aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 18.2 kDa
UniProt: P78983
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Alternaria alternata (Alternaria rot fungus) (Torula alternata)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEAARISAKNALESYAYSLRNTLSDSKVDEKLDAGDKQKLTAEIDKTVQWLDDNQTATKDEYESQQKELEGVANPIMMKFYGAGGEGGMPGGMPGGGMPGGAPGGAAGDDGPTVEEVD
Application Notes: Biological Origin: Alternaria alternata (Alternaria rot fungus) (Torula alternata). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.