Human PRR11 protein

Catalog Number: BYT-ORB358710
Article Name: Human PRR11 protein
Biozol Catalog Number: BYT-ORB358710
Supplier Catalog Number: orb358710
Alternative Catalog Number: BYT-ORB358710-20,BYT-ORB358710-100,BYT-ORB358710-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: FLJ11029 , Homo sapiens proline rich 11 , Proline rich protein 11 , Proline-rich protein 11, PRR 11, Prr11, PRR11_HUMAN, transcription repressor of MHCII
This Human PRR11 protein spans the amino acid sequence from region 1-360aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 56.1 kDa
UniProt: Q96HE9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPKFKQRRRKLKAKAERLFKKKEASHFQSKLITPPPPPPSPERVGISSIDISQSRSWLTSSWNFNFPNIRDAIKLWTNRVWSIYSWCQNCITQSLEVLKDTIFPSRICHRELYSVKQQFCILESKLCKLQEALKTISESSSCPSCGQTCHMSGKLTNVPACVLITPGDSKAVLPPTLPQPASHFPPPPPPPPLPPPPPPLAPVLLRKPSLAKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLIPSPKA
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.