Human TPSB2 protein

Catalog Number: BYT-ORB358709
Article Name: Human TPSB2 protein
Biozol Catalog Number: BYT-ORB358709
Supplier Catalog Number: orb358709
Alternative Catalog Number: BYT-ORB358709-20,BYT-ORB358709-100,BYT-ORB358709-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Tryptase II
This Human TPSB2 protein spans the amino acid sequence from region 31-275aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 31.4 kDa
UniProt: P20231
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.