Fish Parvalbumin beta protein

Catalog Number: BYT-ORB358696
Article Name: Fish Parvalbumin beta protein
Biozol Catalog Number: BYT-ORB358696
Supplier Catalog Number: orb358696
Alternative Catalog Number: BYT-ORB358696-20,BYT-ORB358696-100,BYT-ORB358696-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen, Gad m 1
This Fish Parvalbumin beta protein spans the amino acid sequence from region 2-109aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27.4 kDa
UniProt: Q90YK9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Gadus morhua (Atlantic cod)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
Application Notes: Biological Origin: Gadus morhua (Atlantic cod). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.