Mouse RANKL protein

Catalog Number: BYT-ORB358674
Article Name: Mouse RANKL protein
Biozol Catalog Number: BYT-ORB358674
Supplier Catalog Number: orb358674
Alternative Catalog Number: BYT-ORB358674-20,BYT-ORB358674-100,BYT-ORB358674-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CD254 protein, hRANKL2 protein, ODF protein, OPGL protein, Osteoclast differentiation factor protein, Osteoprotegerin ligand protein, Receptor activator of nuclear factor kappa B ligand protein, Receptor activator of nuclear factor kappa-B ligand protein, TNF related activation induced cytokine protein, TNF-related activation-induced cytokine protein, TNFSF 11 protein, TNFSF11 protein, TRANCE protein, Tumor necrosis factor (ligand) superfamily member 11 protein, Tumor necrosis factor ligand superfamily member 11 protein, Tumor necrosis factor ligand superfamily member 11, soluble form protein
This Mouse RANKL protein spans the amino acid sequence from region 70-316aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.9 kDa
UniProt: O35235
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.