Plant Major pollen allergen Art v 1 protein

Catalog Number: BYT-ORB358666
Article Name: Plant Major pollen allergen Art v 1 protein
Biozol Catalog Number: BYT-ORB358666
Supplier Catalog Number: orb358666
Alternative Catalog Number: BYT-ORB358666-20,BYT-ORB358666-100,BYT-ORB358666-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Defensin-like protein 1 Allergen, Art v 1
This Plant Major pollen allergen Art v 1 protein spans the amino acid sequence from region 25-132aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 26.8 kDa
UniProt: Q84ZX5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Artemisia vulgaris (Mugwort)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
Application Notes: Biological Origin: Artemisia vulgaris (Mugwort). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.