Plant Cor a 1 protein

Catalog Number: BYT-ORB358664
Article Name: Plant Cor a 1 protein
Biozol Catalog Number: BYT-ORB358664
Supplier Catalog Number: orb358664
Alternative Catalog Number: BYT-ORB358664-20,BYT-ORB358664-100,BYT-ORB358664-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Cor a I Allergen, Cor a 1
This Plant Cor a 1 protein spans the amino acid sequence from region 2-160aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 33.4 kDa
UniProt: Q08407
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Corylus avellana (European hazel) (Corylus maxima)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Application Notes: Biological Origin: Corylus avellana (European hazel) (Corylus maxima). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.