Plant Mer a 1 protein

Catalog Number: BYT-ORB358663
Article Name: Plant Mer a 1 protein
Biozol Catalog Number: BYT-ORB358663
Supplier Catalog Number: orb358663
Alternative Catalog Number: BYT-ORB358663-20,BYT-ORB358663-100,BYT-ORB358663-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Pollen allergen Mer a 1 Allergen, Mer a 1
This Plant Mer a 1 protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 30.3 kDa
UniProt: O49894
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mercurialis annua (Annual mercury)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM
Application Notes: Biological Origin: Mercurialis annua (Annual mercury). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.