Bacterial pvdA protein

Catalog Number: BYT-ORB358660
Article Name: Bacterial pvdA protein
Biozol Catalog Number: BYT-ORB358660
Supplier Catalog Number: orb358660
Alternative Catalog Number: BYT-ORB358660-20,BYT-ORB358660-100,BYT-ORB358660-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: L-ornithine N(5)-hydroxylase L-ornithine N(5)-oxygenase Pyoverdin biosynthesis protein A
This Bacterial pvdA protein spans the amino acid sequence from region 1-443aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 65.5 kDa
UniProt: Q51548
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTQATATAVVHDLIGVGFGPSNIALAIALQERAQAQGALEVLFLDKQGDYRWHGNTLVSQSELQISFLKDLVSLRNPTSPYSFVNYLHKHDRLVDFINLGTFYPCRMEFNDYLRWVASHFQEQSRYGEEVLRIEPMLSAGQVEALRVISRNADGEELVRTTRALVVSPGGTPRIPQVFRALKGDGRVFHHSQYLEHMAKQPCSSGKPMKIAIIGGGQSAAEAFIDLNDSYPSVQADMILRASALKPADDSPFVNE
Application Notes: Biological Origin: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.