Human PLA2G5 protein

Catalog Number: BYT-ORB358251
Article Name: Human PLA2G5 protein
Biozol Catalog Number: BYT-ORB358251
Supplier Catalog Number: orb358251
Alternative Catalog Number: BYT-ORB358251-1,BYT-ORB358251-100,BYT-ORB358251-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Group V phospholipase A2 PLA2-10 Phosphatidylcholine 2-acylhydrolase 5
This Human PLA2G5 protein spans the amino acid sequence from region 21-138aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 15.6 kDa
UniProt: P39877
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.