Human MUC2 protein

Catalog Number: BYT-ORB358246
Article Name: Human MUC2 protein
Biozol Catalog Number: BYT-ORB358246
Supplier Catalog Number: orb358246
Alternative Catalog Number: BYT-ORB358246-20,BYT-ORB358246-100,BYT-ORB358246-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Intestinal mucin 2 protein, Intestinal mucin-2 protein, MLP protein, MUC 2 protein, MUC-2 protein, Muc2 protein, MUC2_HUMAN protein, Mucin 2 protein, Mucin 2 intestinal protein, Mucin 2 intestinal/tracheal protein, Mucin 2 oligomeric mucus/gel forming protein, Mucin 2 precursor protein, Mucin 2 tracheal protein, Mucin like protein protein, Mucin-2 protein, Mucin2 protein, SMUC protein
This Human MUC2 protein spans the amino acid sequence from region 36-240aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.8 kDa
UniProt: Q02817
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.