Mouse Loxl1 protein

Catalog Number: BYT-ORB358241
Article Name: Mouse Loxl1 protein
Biozol Catalog Number: BYT-ORB358241
Supplier Catalog Number: orb358241
Alternative Catalog Number: BYT-ORB358241-20,BYT-ORB358241-100,BYT-ORB358241-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Hematopoietin-1
This Mouse Loxl1 protein spans the amino acid sequence from region 95-607aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 58.5 kDa
UniProt: P97873
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RQAPSLPLPGRVGSDTVRGQTRHPFGFGQVPDNWREVAVGDSTGMARARTSVSQQRHGGSASSSVSASAFATTYRQPSPYPQQFPYPQAPFVNQYENYDPASRTYEQGYVYYRGAGGGMGAGAAAVASAGVIYPFQPRARYEDYGGGGGEEQPEYPAQGFYPAPERPYVPQPQPQPQPQPQPQPQPSDGLDRRYSHSLYNEGTPGFEQAYPDPSTDVSQAPAGAGGTYGGAGDPRLGWYPPYAANVPPEAYVPPR
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.