Human EIF2AK2 protein

Catalog Number: BYT-ORB358235
Article Name: Human EIF2AK2 protein
Biozol Catalog Number: BYT-ORB358235
Supplier Catalog Number: orb358235
Alternative Catalog Number: BYT-ORB358235-20,BYT-ORB358235-100,BYT-ORB358235-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Eukaryotic translation initiation factor 2-alpha kinase 2,Interferon-inducible RNA-dependent protein kinase,P1/eIF-2A protein kinase,Protein kinase RNA-activated,Tyrosine-protein kinase EIF2AK2,p68 kinase
Recombinant human EIF2AK2 protein
Molecular Weight: 63.2 kDa
UniProt: P19525
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETK
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.