PAX4 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329645
- Images (7)
| Article Name: | PAX4 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329645 |
| Supplier Catalog Number: | orb329645 |
| Alternative Catalog Number: | BYT-ORB329645-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human PAX4 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti KPD antibody, anti MGC129960 antibody, anti MODY9 antibody |
| Rabbit polyclonal antibody to PAX4 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 38 kDa |
| NCBI: | 006184 |
| UniProt: | O43316 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA |
| Target: | PAX4 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|
|
Sample Tissue: Human NCI-H226, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: COLO205, Antibody Dilution: 1.0 ug/mL, PAX4 is supported by BioGPS gene expression data to be expressed in COLO205. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/mL, PAX4 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells. |
|
|
Sample Tissue: Rat Brain, Antibody Dilution: 1 ug/mL. |
|
|
WB Suggested Anti-PAX4 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate. |
Product Guarantee and Expert Support
