HNF4A Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329630
- Images (7)
| Article Name: | HNF4A Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329630 |
| Supplier Catalog Number: | orb329630 |
| Alternative Catalog Number: | BYT-ORB329630-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N-terminal region of Human HNF4A |
| Conjugation: | Unconjugated |
| Alternative Names: | anti HNF4 antibody, anti HNF4a7 antibody, anti HNF4a8 antibody, anti HNF4a9 antibody, anti HNF4alpha antibody, anti MODY antibody, anti MODY1 antibody, anti NR2A1 antibody, anti NR2A21 antibody, anti TCF antibody, anti TCF14 antibody |
| Rabbit polyclonal antibody to HNF4A |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 53kDa |
| NCBI: | 000448 |
| UniProt: | P41235 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA |
| Target: | HNF4A |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Several isoforms contain the peptide sequence in the range of 57 kDa to 46 kDa, and the protein may be ubiquitinated as well as phosphorylated. |
|
|
Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Rat Skeletal Muscle, Antibody Dilution: 1 ug/mL. |
|
|
WB Suggested Anti-HNF4A Antibody Titration: 0.2-1 ug/mL. A: - blocking peptide. B: + blocking peptide. |
|
|
WB Suggested Anti-HNF4A antibody Titration: 1 ug/mL, Sample Type: Human Liver. |
Product Guarantee and Expert Support
