GCM1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB329549
- Images (7)
| Article Name: | GCM1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB329549 |
| Supplier Catalog Number: | orb329549 |
| Alternative Catalog Number: | BYT-ORB329549-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human GCM1 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti GCMA antibody, anti hGCMa antibody |
| Rabbit polyclonal antibody to GCM1 |
| Clonality: | Polyclonal |
| Concentration: | 0.5 mg/ml |
| Molecular Weight: | 49 kDa |
| NCBI: | 003634 |
| UniProt: | Q9NP62 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK |
| Target: | GCM1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|
|
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 0.5 ug/mL. |
|
|
Human 293T |
|
|
Human Lung |
|
|
Human Spleen |
|
|
WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:7812500, Positive Control: Human Placenta. |
Product Guarantee and Expert Support
