Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
Target:
HNRNPA0
Amount and Sample Type: Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG, Lane 4: hn-RNPA0 ppt. k562 sample, IP Antibody: HNRPA0, Amount of IP Antibody, Primary Antibody: HNRPA0, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPA0.
Lane 1: 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate, Primary Antibody Dilution: 1:4000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:5000, Gene Name: HNRPA0.
