Human Dermcidin protein

Catalog Number: BYT-ORB244156
Article Name: Human Dermcidin protein
Biozol Catalog Number: BYT-ORB244156
Supplier Catalog Number: orb244156
Alternative Catalog Number: BYT-ORB244156-20,BYT-ORB244156-100,BYT-ORB244156-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: AIDD protein, DCD 1 protein, dcd protein, DCD-1 protein, DSEP protein, PIF protein, Preproteolysin protein
This Human Dermcidin protein spans the amino acid sequence from region 20-110aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 36.3 kDa
UniProt: P81605
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein and expression region is 20-110aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.