TAF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2139995
| Article Name: |
TAF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2139995 |
| Supplier Catalog Number: |
orb2139995 |
| Alternative Catalog Number: |
BYT-ORB2139995-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ChIP, IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human TAF1 |
| Conjugation: |
Biotin |
| Alternative Names: |
OF, XDP, BA2R, CCG1, CCGS, DYT3, KAT4, P250, NSCL2, TAF2A, MRXS33, N-TAF1, TAFII250, DYT3/TAF1, TAFII-250, TAF(II)250 |
| TAF1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
215kDa |
| NCBI: |
620278 |
| UniProt: |
P21675 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE |
