SRC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2139992
Article Name: SRC Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139992
Supplier Catalog Number: orb2139992
Alternative Catalog Number: BYT-ORB2139992-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SRC
Conjugation: FITC
Alternative Names: ASV, SRC1, THC6, c-SRC, p60-Src
SRC Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 938033
UniProt: P12931
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGP