REST Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2139980
Article Name: REST Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139980
Supplier Catalog Number: orb2139980
Alternative Catalog Number: BYT-ORB2139980-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REST
Conjugation: FITC
Alternative Names: WT6, XBR, HGF5, NRSF, DFNA27, GINGF5
REST Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 122kDa
NCBI: 005603
UniProt: Q13127
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD