C20orf194 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2139728
Article Name: C20orf194 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139728
Supplier Catalog Number: orb2139728
Alternative Catalog Number: BYT-ORB2139728-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf194
Conjugation: HRP
Alternative Names: C20orf194
C20orf194 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 99kDa
NCBI: 22530
UniProt: Q5TEA3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SFAKHMVAQCVSPKGPLACSRTYFFGATHVPYLGGDSKLPKKTEQIRLLS