C20orf194 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2139726
Article Name: C20orf194 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139726
Supplier Catalog Number: orb2139726
Alternative Catalog Number: BYT-ORB2139726-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf194
Conjugation: Biotin
Alternative Names: C20orf194
C20orf194 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 99kDa
NCBI: 22530
UniProt: Q5TEA3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SFAKHMVAQCVSPKGPLACSRTYFFGATHVPYLGGDSKLPKKTEQIRLLS