ZBTB20 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2139711
Article Name: ZBTB20 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139711
Supplier Catalog Number: orb2139711
Alternative Catalog Number: BYT-ORB2139711-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZBTB20
Conjugation: FITC
Alternative Names: HOF, DPZF, PRIMS, ODA-8S, ZNF288
ZBTB20 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 056457
UniProt: Q9HC78
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPA