Recombinant Human Interleukin-6 (IL6) Protein (Active)

Catalog Number: BYT-ORB1881858
Article Name: Recombinant Human Interleukin-6 (IL6) Protein (Active)
Biozol Catalog Number: BYT-ORB1881858
Supplier Catalog Number: orb1881858
Alternative Catalog Number: BYT-ORB1881858-1,BYT-ORB1881858-100,BYT-ORB1881858-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interleukin-6, IL-6, B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IL6 , IFNB2
This Recombinant Human Interleukin-6 (IL6) Protein (Active) spans the amino acid sequence from region 30-212aa. Purity: Greater than 95% as determined by SDS-PAGE
Molecular Weight: 22.8 kDa
UniProt: P05231
Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE
Form: Lyophilized powder
Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
orb1881858
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL.