Recombinant Lactobacillus casei 60 kDa chaperonin (groL), partial

Catalog Number: BYT-ORB1785229
Article Name: Recombinant Lactobacillus casei 60 kDa chaperonin (groL), partial
Biozol Catalog Number: BYT-ORB1785229
Supplier Catalog Number: orb1785229
Alternative Catalog Number: BYT-ORB1785229-1,BYT-ORB1785229-100,BYT-ORB1785229-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (60 kDa chaperonin)(Chaperonin-60)(Cpn60)
This Recombinant Lactobacillus casei 60 kDa chaperonin (groL), partial spans the amino acid sequence from region 182-374aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 28.4 kDa
UniProt: B3W9W7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Lacticaseibacillus casei (strain BL23) (Lactobacillus casei)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DTELSVVEGMQFDRGYLSQYMVTDNDKMEADLDDPYILITDKKISNIQDILPLLQEIVQQGKALLIIADDVAGEALPTLVLNKIRGTFNVVAVKAPGFGDRRKAQLEDIATLTGGTVISSDLGLDLKDTKLEQLGRAGKVTVTKDNTTIVDGAGSKDAIAERVNIIKKQIDDTTSDFDREKLQERLAKLAGGV
Application Notes: Biological Origin: Lacticaseibacillus casei (strain BL23) (Lactobacillus casei). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.