Legionella pneumophila subsp. pneumophila 50S ribosomal protein L7/L12 Protein

Catalog Number: BYT-ORB1476932
Article Name: Legionella pneumophila subsp. pneumophila 50S ribosomal protein L7/L12 Protein
Biozol Catalog Number: BYT-ORB1476932
Supplier Catalog Number: orb1476932
Alternative Catalog Number: BYT-ORB1476932-1,BYT-ORB1476932-100,BYT-ORB1476932-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Legionella pneumophila subsp. pneumophila 50S ribosomal protein L7/L12 Protein spans the amino acid sequence from region 1-126aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 20.4 kDa
UniProt: Q5ZYQ1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAVSKNEILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAPAAGAGAAAAEEQTEFTVVMTSFGSNKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGVSKDEAASIKKELEEAGATVEVK
Application Notes: Biological Origin: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.