Rat Dhodh Protein

Catalog Number: BYT-ORB1476929
Article Name: Rat Dhodh Protein
Biozol Catalog Number: BYT-ORB1476929
Supplier Catalog Number: orb1476929
Alternative Catalog Number: BYT-ORB1476929-1,BYT-ORB1476929-100,BYT-ORB1476929-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ((DHOdehase)(Dihydroorotate oxidase)
This Rat Dhodh Protein spans the amino acid sequence from region 31-395aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 43.5 kDa
UniProt: Q63707
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TGDDHFYAEYLMPGLQRLLDPESAHRLAVRVTSLGLLPRATFQDSDMLEVKVLGHKFRNPVGIAAGFDKNGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAQLTADGLPLGINLGKNKTSEDAAADYAEGVRTLGPLADYLVVNVSSPNTAGLRSLQGKTELRHLLSKVLQERDALKGTRKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIVTNTT
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.