At5g42100 Protein

Catalog Number: BYT-ORB1476869
Article Name: At5g42100 Protein
Biozol Catalog Number: BYT-ORB1476869
Supplier Catalog Number: orb1476869
Alternative Catalog Number: BYT-ORB1476869-1,BYT-ORB1476869-100,BYT-ORB1476869-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ((1->3)-beta-glucan endohydrolase 10)((1->3)-beta-glucanase 10)(Beta-1,3-endoglucanase 10)(Beta-1,3-glucanase 10)(Putative plasmodesmal associated protein)(AtBG_ppap)
This At5g42100 Protein spans the amino acid sequence from region 27-425aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 71.5 kDa
UniProt: Q9FHX5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGAT
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.