Human L-serine dehydratase/L-threonine deaminase Protein

Catalog Number: BYT-ORB1476754
Article Name: Human L-serine dehydratase/L-threonine deaminase Protein
Biozol Catalog Number: BYT-ORB1476754
Supplier Catalog Number: orb1476754
Alternative Catalog Number: BYT-ORB1476754-1,BYT-ORB1476754-100,BYT-ORB1476754-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (SDH)(L-serine deaminase)(L-threonine dehydratase)(TDH)
This Human L-serine dehydratase/L-threonine deaminase Protein spans the amino acid sequence from region 1-328aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 42.1 kDa
UniProt: P20132
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAI
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.