Recombinant Human Glucocorticoid receptor (NR3C1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC29473
Article Name: Recombinant Human Glucocorticoid receptor (NR3C1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC29473
Supplier Catalog Number: RPC29473
Alternative Catalog Number: BIM-RPC29473-20UG,BIM-RPC29473-100UG,BIM-RPC29473-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Nuclear receptor subfamily 3 group C member 1 GRL
Recombinant Human Glucocorticoid receptor (NR3C1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Glucocorticoid receptor (NR3C1) . Accession Number: P04150, NR3C1. Expression Region: 521-777aa. Tag Info: N-terminal 10xHis-GST-tagged. Theoretical MW: 61.3kda. Target Synonyms: Nuclear receptor subfamily 3 group C member 1 GRL Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 61.3kDa
Tag: N-Terminal 10xHis-GST-Tagged
Purity: >85% by SDS-PAGE
Sequence: VPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFH
Target: Glucocorticoid receptor (NR3C1)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL