Recombinant Human Hepatocyte nuclear factor 3-alpha (FOXA1), Unconjugated, E. coli

Catalog Number: BIM-RPC29470
Article Name: Recombinant Human Hepatocyte nuclear factor 3-alpha (FOXA1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC29470
Supplier Catalog Number: RPC29470
Alternative Catalog Number: BIM-RPC29470-20UG,BIM-RPC29470-100UG,BIM-RPC29470-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Forkhead box protein A1, Transcription factor 3A, TCF-3A
Recombinant Human Hepatocyte nuclear factor 3-alpha (FOXA1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Hepatocyte nuclear factor 3-alpha (FOXA1) . Accession Number: P55317, FOXA1. Expression Region: 1-472aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 56.6kda. Target Synonyms: Forkhead box protein A1, Transcription factor 3A, TCF-3A Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 56.6kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFE
Target: Hepatocyte nuclear factor 3-alpha (FOXA1)