Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) -VLPs, Unconjugated, Mammal

Catalog Number: BIM-RPC29462
Article Name: Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) -VLPs, Unconjugated, Mammal
Biozol Catalog Number: BIM-RPC29462
Supplier Catalog Number: RPC29462
Alternative Catalog Number: BIM-RPC29462-20UG,BIM-RPC29462-100UG,BIM-RPC29462-1MG
Manufacturer: Biomatik Corporation
Host: Mammal
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: KK-LC-1, Cancer/testis antigen 83
Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) -VLPs is a purified MP-VLP Transmembrane Protein. Purity: The purity information is not available for VLPs proteins. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens). Target Name: Kita-kyushu lung cancer antigen 1 (CT83) -VLPs. Accession Number: Q5H943, CT83. Expression Region: 1-113aa. Tag Info: N-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions) . Theoretical MW: 14kda. Target Synonyms: KK-LC-1, Cancer/testis antigen 83 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 14kDa
Tag: N-Terminal 6xHis-Tagged (This tag can be tested only under denaturing conditions)
Purity: The purity information is not available for VLPs proteins
Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Target: Kita-kyushu lung cancer antigen 1 (CT83) -VLPs