Recombinant Human TGF-beta receptor type-1 (TGFBR1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC29453
Article Name: Recombinant Human TGF-beta receptor type-1 (TGFBR1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC29453
Supplier Catalog Number: RPC29453
Alternative Catalog Number: BIM-RPC29453-20UG,BIM-RPC29453-100UG,BIM-RPC29453-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: TGFR-1, Activin A receptor type II-like protein kinase of 53kD, Activin receptor-like kinase 5, ALK-5, ALK5, Serine/threonine-protein kinase receptor R4, SKR4, TGF-beta type I receptor, Transforming growth factor-beta receptor type I, TGF-beta receptor type I, TbetaR-I
Recombinant Human TGF-beta receptor type-1 (TGFBR1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TGF-beta receptor type-1 (TGFBR1) . Accession Number: P36897, TGFBR1. Expression Region: 34-126aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 17.6kda. Target Synonyms: TGFR-1, Activin A receptor type II-like protein kinase of 53kD, Activin receptor-like kinase 5, ALK-5, ALK5, Serine/threonine-protein kinase receptor R4, SKR4, TGF-beta type I receptor, Transforming growth factor-beta receptor type I, TGF-beta receptor type I, TbetaR-I Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.6kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL
Target: TGF-beta receptor type-1 (TGFBR1)