Recombinant Human D-glucuronyl C5-epimerase (GLCE), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC29452
Article Name: Recombinant Human D-glucuronyl C5-epimerase (GLCE), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC29452
Supplier Catalog Number: RPC29452
Alternative Catalog Number: BIM-RPC29452-20UG,BIM-RPC29452-100UG,BIM-RPC29452-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Heparan sulfate C5-epimerase, HsepiHeparin/heparan sulfate:glucuronic acid C5-epimeraseHeparosan-N-sulfate-glucuronate 5-epimerase
Recombinant Human D-glucuronyl C5-epimerase (GLCE), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: D-glucuronyl C5-epimerase (GLCE) . Accession Number: O94923, GLCE. Expression Region: 29-617aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 70.9kda. Target Synonyms: Heparan sulfate C5-epimerase, HsepiHeparin/heparan sulfate:glucuronic acid C5-epimeraseHeparosan-N-sulfate-glucuronate 5-epimerase Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 70.9kDa
Tag: N-Terminal 6xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: NKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAEDRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSEGVS
Target: D-glucuronyl C5-epimerase (GLCE)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL