Recombinant Mouse cGMP-specific 3, 5-cyclic phosphodiesterase (Pde5a), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC26238
Article Name: Recombinant Mouse cGMP-specific 3, 5-cyclic phosphodiesterase (Pde5a), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26238
Supplier Catalog Number: RPC26238
Alternative Catalog Number: BIM-RPC26238-20UG,BIM-RPC26238-100UG,BIM-RPC26238-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE, Pde5)
Recombinant Mouse cGMP-specific 3, 5-cyclic phosphodiesterase (Pde5a), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Pde5a. Target Synonyms: cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE, Pde5). Accession Number: Q8CG03. Expression Region: 154~320aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN
Target: Pde5a