Recombinant Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase, Unconjugated, E. coli

Catalog Number: BIM-RPC26197
Article Name: Recombinant Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26197
Supplier Catalog Number: RPC26197
Alternative Catalog Number: BIM-RPC26197-20UG,BIM-RPC26197-100UG,BIM-RPC26197-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Poly(3-hydroxybutyrate) depolymerase, PHB depolymerase, EC 3.1.1.75
Recombinant Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Ralstonia pickettii (Burkholderia pickettii). Target Name: Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase. Target Synonyms: Poly(3-hydroxybutyrate) depolymerase, PHB depolymerase, EC 3.1.1.75. Accession Number: P12625. Expression Region: 28~488aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 50.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 50.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: ATAGPGAWSSQQTWAADSVNGGNLTGYFYWPASQPTTPNGKRALVLVLHGCVQTASGDVIDNANGAGFNWKSVADQYGAVILAPNATGNVYSNHCWDYANASPSRTAGHVGVLLDLVNRFVTNSQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTAQIGYVPSGFTATTAANKCNAWAGSNAGKFSTQIAGAVWGTSDYTVAQAYGPMDAAAMRLVYGGNFTQGSQVSISGGGTNTPYT
Target: Ralstonia pickettii Poly (3-hydroxybutyrate) depolymerase