Recombinant Neurospora crassa Chorismate synthase (aro-2), Unconjugated, E. coli

Catalog Number: BIM-RPC26193
Article Name: Recombinant Neurospora crassa Chorismate synthase (aro-2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26193
Supplier Catalog Number: RPC26193
Alternative Catalog Number: BIM-RPC26193-20UG,BIM-RPC26193-100UG,BIM-RPC26193-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: 5-enolpyruvylshikimate-3-phosphate phospholyase
Recombinant Neurospora crassa Chorismate synthase (aro-2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987). Target Name: aro-2. Target Synonyms: 5-enolpyruvylshikimate-3-phosphate phospholyase. Accession Number: Q12640. Expression Region: 1~432aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 46.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 46.8kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSTFGHYFRVTTYGESHCKSVGCIVDGVPPGMELTEDDIQPQMTRRRPGQSAITTPRDEKDRVIIQSGTEFGVTLGTPIGMLVMNEDQRPKDYGNKTMDIYPRPSHADWTYLEKYGVKASSGGGRSSARETIGRVAAGAIAEKYLKLAYGVEIVAFVSSVGSEHLFPPTAEHPSPSTNPEFLKLVNSITRETVDSFLPVRCPDAEANKRMEDLITKFRDNHDSIGGTVTCVIRNVPSGLGEPAFDKLEAMLAHAM
Target: aro-2