Recombinant Mouse Merlin (Nf2), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC26188
Article Name: Recombinant Mouse Merlin (Nf2), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26188
Supplier Catalog Number: RPC26188
Alternative Catalog Number: BIM-RPC26188-20UG,BIM-RPC26188-100UG,BIM-RPC26188-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Moesin-ezrin-radixin-like protein (Neurofibromin-2, Schwannomin, Nf-2)
Recombinant Mouse Merlin (Nf2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Nf2. Target Synonyms: Moesin-ezrin-radixin-like protein (Neurofibromin-2, Schwannomin, Nf-2). Accession Number: P46662. Expression Region: 1~320aa. Tag Info: N-Terminal 6Xhis-Trx-Tagged. Theoretical MW: 55.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 55.9kDa
Tag: N-Terminal 6Xhis-Trx-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKIS
Target: Nf2