Recombinant Human Peptidoglycan recognition protein 1 (PGLYRP1), Unconjugated, E. coli

Catalog Number: BIM-RPC26187
Article Name: Recombinant Human Peptidoglycan recognition protein 1 (PGLYRP1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26187
Supplier Catalog Number: RPC26187
Alternative Catalog Number: BIM-RPC26187-20UG,BIM-RPC26187-100UG,BIM-RPC26187-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Peptidoglycan recognition protein short (PGRP-S, PGLYRP, PGRP, TNFSF3L)
Recombinant Human Peptidoglycan recognition protein 1 (PGLYRP1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PGLYRP1. Target Synonyms: Peptidoglycan recognition protein short (PGRP-S, PGLYRP, PGRP, TNFSF3L). Accession Number: O75594. Expression Region: 22~196aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP
Target: PGLYRP1