Recombinant Candida albicans Hyphal wall protein 1 (HWP1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC26178
Article Name: Recombinant Candida albicans Hyphal wall protein 1 (HWP1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26178
Supplier Catalog Number: RPC26178
Alternative Catalog Number: BIM-RPC26178-20UG,BIM-RPC26178-100UG,BIM-RPC26178-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: Cell elongation protein 2 (ECE2)
Recombinant Candida albicans Hyphal wall protein 1 (HWP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). Target Name: HWP1. Target Synonyms: Cell elongation protein 2 (ECE2). Accession Number: P46593. Expression Region: 27~203aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GQGETEEALIQKRSYDYYQEPCDDYPQQQQQQEPCDYPQQQQQEEPCDYPQQQPQEPCDYPQQPQEPCDYPQQPQEPCDYPQQPQEPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDVPCDNPPQPDQPDDNPPIPNIPTDWIPNIPTDWIPDIPEKPTTPATTPNIPA
Target: HWP1