Recombinant Human Lysyl oxidase homolog 1 (LOXL1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC26173
Article Name: Recombinant Human Lysyl oxidase homolog 1 (LOXL1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26173
Supplier Catalog Number: RPC26173
Alternative Catalog Number: BIM-RPC26173-20UG,BIM-RPC26173-100UG,BIM-RPC26173-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Lysyl oxidase-like protein 1 (LOL, LOXL)
Recombinant Human Lysyl oxidase homolog 1 (LOXL1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: LOXL1. Target Synonyms: Lysyl oxidase-like protein 1 (LOL, LOXL). Accession Number: Q08397. Expression Region: 106~574aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 55.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 55.4kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: VGSDTVRGQARHPFGFGQVPDNWREVAVGDSTGMARARTSVSQQRHGGSASSVSASAFASTYRQQPSYPQQFPYPQAPFVSQYENYDPASRTYDQGFVYYRPAGGGVGAGAAAVASAGVIYPYQPRARYEEYGGGEELPEYPPQGFYPAPERPYVPPPPPPPDGLDRRYSHSLYSEGTPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVY
Target: LOXL1