Recombinant Mouse Interleukin-18 (Il18), Unconjugated, E. coli

Catalog Number: BIM-RPC26168
Article Name: Recombinant Mouse Interleukin-18 (Il18), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26168
Supplier Catalog Number: RPC26168
Alternative Catalog Number: BIM-RPC26168-20UG,BIM-RPC26168-100UG,BIM-RPC26168-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Interferon gamma-inducing factor (IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma, IL-18, Igif)
Recombinant Mouse Interleukin-18 (Il18) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Il18. Target Synonyms: Interferon gamma-inducing factor (IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma, IL-18, Igif). Accession Number: P70380. Expression Region: 1~192aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Target: Il18