Recombinant Human Apolipoprotein C-I (APOC1), Unconjugated, E. coli

Catalog Number: BIM-RPC26165
Article Name: Recombinant Human Apolipoprotein C-I (APOC1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26165
Supplier Catalog Number: RPC26165
Alternative Catalog Number: BIM-RPC26165-20UG,BIM-RPC26165-100UG,BIM-RPC26165-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Apolipoprotein C1 (Apo-CI, ApoC-I)
Recombinant Human Apolipoprotein C-I (APOC1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: APOC1. Target Synonyms: Apolipoprotein C1 (Apo-CI, ApoC-I). Accession Number: P02654. Expression Region: 27~83aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 22.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 22.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Target: APOC1