Recombinant Bovine Ferrochelatase, mitochondrial (FECH), Unconjugated, E. coli

Catalog Number: BIM-RPC26152
Article Name: Recombinant Bovine Ferrochelatase, mitochondrial (FECH), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26152
Supplier Catalog Number: RPC26152
Alternative Catalog Number: BIM-RPC26152-20UG,BIM-RPC26152-100UG,BIM-RPC26152-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bovine
Conjugation: Unconjugated
Alternative Names: Heme synthase (Protoheme ferro-lyase)
Recombinant Bovine Ferrochelatase, mitochondrial (FECH) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: FECH. Target Synonyms: Heme synthase (Protoheme ferro-lyase). Accession Number: P22600. Expression Region: 48~416aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Taggedd. Theoretical MW: 58.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 58.1kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Taggedd
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SPKPQAQPGNRKPRTGILMLNMGGPETVEEVQDFLQRLFLDQDLMTLPVQDKLGPFIAKRRTPKIQEQYRRIGGGSPIKMWTSKQGEGMVKLLDELSPHTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAVAFTQYPQYSCSTTGSSLNAIYRYYNEVGRKPTMKWSTIDRWPTHPLLIQCFADHILKELDHFPPEKRREVVILFSAHSLPMSVVNRGDPYPQEVGATVQRVMDKLGYSNPYRLVWQSKVGPMP
Target: FECH