Recombinant Human AP-1 complex subunit beta-1 (AP1B1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC26133
Article Name: Recombinant Human AP-1 complex subunit beta-1 (AP1B1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26133
Supplier Catalog Number: RPC26133
Alternative Catalog Number: BIM-RPC26133-20UG,BIM-RPC26133-100UG,BIM-RPC26133-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Adaptor protein complex AP-1 subunit beta-1 (Adaptor-related protein complex 1 subunit beta-1, Beta-1-adaptin, Beta-adaptin 1, Clathrin assembly protein complex 1 beta large chain, Golgi adaptor HA1/AP1 adaptin beta subunit, ADTB1, BAM22, CLAPB2)
Recombinant Human AP-1 complex subunit beta-1 (AP1B1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: AP1B1. Target Synonyms: Adaptor protein complex AP-1 subunit beta-1 (Adaptor-related protein complex 1 subunit beta-1, Beta-1-adaptin, Beta-adaptin 1, Clathrin assembly protein complex 1 beta large chain, Golgi adaptor HA1/AP1 adaptin beta subunit, ADTB1, BAM22, CLAPB2). Accession Number: Q10567. Expression Region: 1~584aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 73.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 73.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MTDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSICERVTPRLSHANSAV
Target: AP1B1