Recombinant Torpedo californica Acetylcholine receptor subunit alpha (CHRNA1), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC26121
Article Name: Recombinant Torpedo californica Acetylcholine receptor subunit alpha (CHRNA1), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC26121
Supplier Catalog Number: RPC26121
Alternative Catalog Number: BIM-RPC26121-20UG,BIM-RPC26121-100UG,BIM-RPC26121-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: CHRNA1Acetylcholine receptor subunit alpha
Recombinant Torpedo californica Acetylcholine receptor subunit alpha (CHRNA1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Tetronarce californica (Pacific electric ray) (Torpedo californica). Target Name: CHRNA1. Target Synonyms: CHRNA1Acetylcholine receptor subunit alpha. Accession Number: P02710. Expression Region: 25~234aa. Tag Info: N-Terminal 6Xhis-Sumostar-Tagged. Theoretical MW: 37.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.9kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI
Target: CHRNA1