Recombinant Rat Anionic trypsin-2 (Prss2), Unconjugated, Yeast

Catalog Number: BIM-RPC26107
Article Name: Recombinant Rat Anionic trypsin-2 (Prss2), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC26107
Supplier Catalog Number: RPC26107
Alternative Catalog Number: BIM-RPC26107-20UG,BIM-RPC26107-100UG,BIM-RPC26107-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Anionic trypsin II (Pretrypsinogen II, Serine protease 2, Try2)
Recombinant Rat Anionic trypsin-2 (Prss2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Prss2. Target Synonyms: Anionic trypsin II (Pretrypsinogen II, Serine protease 2, Try2). Accession Number: P00763. Expression Region: 24~246aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Target: Prss2